DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrdc1a

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_005171840.1 Gene:arrdc1a / 100006005 ZFINID:ZDB-GENE-030925-15 Length:447 Species:Danio rerio


Alignment Length:470 Identity:121/470 - (25%)
Similarity:197/470 - (41%) Gaps:74/470 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ERLRITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRS 68
            :...||.|:...||..|:.:.|.:.:::.:..:.:||||..  :|.|.    :...||:.:    
Zfish     5 QEFEITFDNNKTVYSPGESLTGTLKISIAQSIQCKAIKVNC--QGFCG----VTSKSNDTD---- 59

  Fly    69 LFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLIQRP 133
              :|.:|.|..|...:.|   :| .|..|||:|.|:..|....|:||.|.||.|.|::|..|..|
Zfish    60 --WTDEEQYFSSSVSIAD---KG-TLKEGEHSFPFKFLLPAAAPTSFVGPYGQIMYRVRAFIDTP 118

  Fly   134 -WTFDERHTIPFTVVKNMPLQ--PMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFA--VRG 193
             :..|.:...||::...:.|.  |..|. |||  ..|||..|....:..|::.....|..  :.|
Zfish   119 RFAKDYKIEKPFSMTNTLNLNEVPGIRE-PSS--SSVTKNFSYMLVKNGTVVLNAKTDMRGYIAG 180

  Fly   194 EPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVP---LRVQKVECIAVATKETGSVQKKTERSF 255
            :.:::.|.:.|.|......:..:::|.|||.:..|   ||       :||..|...|:...:..:
Zfish   181 QIIKVSAGIENKSDKTTGHVVASLMQKVTYNTKKPTYDLR-------SVAEVEGPGVKGGNKSEW 238

  Fly   256 AHELLLPDGAQPTDEQMSG-VITIVYELRVEAVLRGFFKNLILNLPFKVYS--QDPS--NRQSSL 315
            ..::::|  |.|......| :|.|.|.::|  .|:  :..:.|.||..:.|  .|||  :...::
Zfish   239 NQQIIVP--ALPHSSLSDGNLIQICYYIQV--YLK--YPEVALTLPICIGSVALDPSQPSHSQTV 297

  Fly   316 RPPPPPR--PNDGPPGPELGSGNLFEPALPV-----YPSLDSSIGSPSHS--SQFSECSSINSIT 371
            .|.|.||  |...|..||..:.||  |..|.     .|...|:..|||..  ..:.:..|:::..
Zfish   298 APMPAPRITPAPSPSAPESEASNL--PPRPAPKPAPKPRPRSTHASPSAPPVDLYPQLPSVSNYN 360

  Fly   372 SD---------SSAATLSPAVGAGTGGMDMSYTSGSQSSQYGSPSARTSLRSSNVPYMPYSSSPL 427
            .:         .|...:||...:...|:.......|.......||..:|.:..|  .||.|:   
Zfish   361 GEMLKSPHQEPGSQGPVSPNAFSYAPGLSFRQRQSSSGPSAPPPSLSSSSQDRN--QMPSSA--- 420

  Fly   428 MVQSYPPPH-LPAYP 441
               |.||.: ..|||
Zfish   421 ---SVPPSYRSSAYP 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 42/146 (29%)
Arrestin_C 178..305 CDD:280848 29/132 (22%)
arrdc1aXP_005171840.1 Arrestin_N 7..139 CDD:304627 42/147 (29%)
Arrestin_C 162..283 CDD:280848 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.