DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ADK1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_010512.1 Gene:ADK1 / 851812 SGDID:S000002634 Length:222 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:80/205 - (39%)
Similarity:113/205 - (55%) Gaps:8/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTK 71
            |.|:||.||:||||.:..:.:.....|::|||:||..|.|.|:||.:||:.:.:|.||.|.|:..
Yeast     8 RMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVN 72

  Fly    72 TMLARITE--VGNRSYILDGFPRNIAQAEAL--AAREQ---IDAVITLDVPHSVIIDRVKNRWIH 129
            .:...:|.  .....:|||||||.|.|||.|  ..:||   ::..|.|.|...:::.|:..|.||
Yeast    73 MIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIH 137

  Fly   130 APSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATF 194
            ..|||.|:..|..||...|||||||.|:||.||....:.|||..|.....|::.:|:|.|:.|..
Yeast   138 PASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGV 202

  Fly   195 KGKQ-TKEIW 203
            ...| ...:|
Yeast   203 DASQPPATVW 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 80/205 (39%)
ADK 7..201 CDD:238713 79/201 (39%)
ADK1NP_010512.1 adk 8..221 CDD:234711 80/205 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.