DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ADK1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_201145.1 Gene:ADK1 / 836459 AraportID:AT5G63400 Length:246 Species:Arabidopsis thaliana


Alignment Length:205 Identity:80/205 - (39%)
Similarity:117/205 - (57%) Gaps:14/205 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTK 71
            |.:.||.|||||||.|.::...:...|:||||:||..:...|.||.|||:.:.:|:||.|.:|  
plant    35 RLIFIGPPGSGKGTQSPVVKDEYCLCHLSTGDMLRAAVASKTPLGVKAKEAMEKGELVSDDLV-- 97

  Fly    72 TMLARITEVGN-----RSYILDGFPRNIAQAEAL-----AAREQIDAVITLDVPHSVIIDRVKNR 126
              :..|.|..|     :.:|||||||.:.|||.|     ....:||.|:...:..:::.:|:..|
plant    98 --VGIIDEAMNKPKCQKGFILDGFPRTVTQAEKLDEMLKRRGTEIDKVLNFAIDDAILEERITGR 160

  Fly   127 WIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLV 191
            |||..|||.|:..|..||.||.||:|||||:||:||...|:..||..:.....|||.:|.||.::
plant   161 WIHPSSGRSYHTKFAPPKTPGVDDITGEPLIQRKDDNADVLKSRLAAFHSQTQPVIDYYAKKAVL 225

  Fly   192 ATFKGKQTKE 201
            ...:.::..:
plant   226 TNIQAEKAPQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 80/205 (39%)
ADK 7..201 CDD:238713 80/203 (39%)
ADK1NP_201145.1 PLN02674 3..246 CDD:178279 80/205 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.