DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and AMK2

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_199595.1 Gene:AMK2 / 834835 AraportID:AT5G47840 Length:283 Species:Arabidopsis thaliana


Alignment Length:198 Identity:70/198 - (35%)
Similarity:116/198 - (58%) Gaps:9/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTK 71
            :.:|.|||.|||||..|||...:|.||||.||:||..|...:|.|::||:::.:|:||||.||..
plant    66 KIMISGAPASGKGTQCELITHKYGLVHISAGDLLRAEIASGSENGRRAKEHMEKGQLVPDEIVVM 130

  Fly    72 TMLARI--TEVGNRSYILDGFPRNIAQAEALAA-REQIDAVITLDVPHSVIIDRVKNRWIHAPSG 133
            .:..|:  |:...:.::|||:||:.:||.||.. ..|.|..|.|:||..::|:||..|.:...:|
plant   131 MVKDRLSQTDSEQKGWLLDGYPRSASQATALKGFGFQPDLFIVLEVPEEILIERVVGRRLDPVTG 195

  Fly   134 RVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQ 198
            ::|::.:..|:.    :.....|.||.||.......||:.:::.:|.|::.|:  .:....:|.:
plant   196 KIYHLKYSPPET----EEIAVRLTQRFDDTEEKAKLRLKTHNQNVSDVLSMYD--DITIKIEGNR 254

  Fly   199 TKE 201
            :||
plant   255 SKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 70/198 (35%)
ADK 7..201 CDD:238713 68/196 (35%)
AMK2NP_199595.1 adk 66..268 CDD:273569 70/198 (35%)
ADK 66..259 CDD:238713 70/198 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.