DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and AT5G35170

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_198367.2 Gene:AT5G35170 / 833471 AraportID:AT5G35170 Length:588 Species:Arabidopsis thaliana


Alignment Length:236 Identity:78/236 - (33%)
Similarity:119/236 - (50%) Gaps:34/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTK 71
            :.:|.|||.|||||..|||....|.|||||||:||..:...|::||:||:::..|.||||.||..
plant    81 KVMISGAPASGKGTQCELIVHKFGLVHISTGDLLRAEVSSGTDIGKRAKEFMNSGSLVPDEIVIA 145

  Fly    72 TMLARIT--EVGNRSYILDGFPRNIAQAEAL-AAREQIDAVITLDVPHSVIIDRVKNRWIHAPSG 133
            .:..|::  :.....::||||||:.|||::| ....:.|..|.||||..::|||...|.:...:|
plant   146 MVAGRLSREDAKEHGWLLDGFPRSFAQAQSLDKLNVKPDIFILLDVPDEILIDRCVGRRLDPVTG 210

  Fly   134 RVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWY------------- 185
            ::|:|  ||  .|.:.|.....|:.|.||....|..||::|.:....:|:.|             
plant   211 KIYHI--KN--YPPESDEIKARLVTRPDDTEEKVKARLQIYKQNSEAIISAYSDVMVKIDANRPK 271

  Fly   186 --------------EKKGLVATFKGKQTKEIWPMMELFLND 212
                          :.|.::.|.|....::.|..:...||:
plant   272 EVVFEETQTLLSQIQLKRMIKTDKASPVQDKWRGIPTRLNN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 76/233 (33%)
ADK 7..201 CDD:238713 75/223 (34%)
AT5G35170NP_198367.2 ADK 81..274 CDD:238713 72/196 (37%)
PLN02842 83..585 CDD:178435 78/234 (33%)
DUF1995 321..558 CDD:286442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.