DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and AT2G39270

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_850314.1 Gene:AT2G39270 / 818512 AraportID:AT2G39270 Length:295 Species:Arabidopsis thaliana


Alignment Length:206 Identity:66/206 - (32%)
Similarity:102/206 - (49%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVT 70
            |..|.:|.||.||||.:..:....|..||:|||::|:.:..:..|..:.|:.:..||||||..:.
plant    65 FHWVFLGCPGVGKGTYASRLSSLLGVPHIATGDLVREELSSSGLLSSQLKELVNHGKLVPDEFII 129

  Fly    71 KTMLARI---TEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPS 132
            ..:..|:   .:.|...||||||||.:.|||.|.....||.||.|.:....::.:...|.|.:..
plant   130 SLLSKRLQAGKDKGESGYILDGFPRTVTQAEILEGVTNIDLVINLKLREEALLAKCLGRRICSEC 194

  Fly   133 GRVYNIGFKNPKVPGKDDV-------------TGEPLMQREDDKPHVVAKRLELYDEVMSPVIAW 184
            |..||:...:  :.|.||.             ....|:.|.||...||.:||.:|:::..||..:
plant   195 GGNYNVACID--IKGDDDTPRMYMPPLLPPPNCESKLISRADDTEEVVKERLRIYNKMTQPVEEF 257

  Fly   185 YEKKGLVATFK 195
            |:|:|.:..|:
plant   258 YKKRGKLLEFE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 65/205 (32%)
ADK 7..201 CDD:238713 65/205 (32%)
AT2G39270NP_850314.1 PLN02459 37..295 CDD:215253 66/206 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.