DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ADK

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_181262.1 Gene:ADK / 818302 AraportID:AT2G37250 Length:284 Species:Arabidopsis thaliana


Alignment Length:223 Identity:72/223 - (32%)
Similarity:111/223 - (49%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTM 73
            |.:|.||.||||.:..:....|..||:|||::|:.:..:..|.:|..:.:.:||||.|.|:...:
plant    55 VFLGCPGVGKGTYASRLSTLLGVPHIATGDLVREELASSGPLSQKLSEIVNQGKLVSDEIIVDLL 119

  Fly    74 LARI---TEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRV 135
            ..|:   ...|...:|||||||.:.|||.|.....||.|:.|.:|..|::|:...|...:..|:.
plant   120 SKRLEAGEARGESGFILDGFPRTMRQAEILGDVTDIDLVVNLKLPEEVLVDKCLGRRTCSQCGKG 184

  Fly   136 YNIGFKNPK-VPGKDDVTGEPLM----------QREDDKPHVVAKRLELYDEVMSPVIAWYEKKG 189
            :|:...|.| ..|:..::.:||:          .|.||...||..||.:|:|...|:..:|..||
plant   185 FNVAHINLKGENGRPGISMDPLLPPHQCMSKLVTRADDTEEVVKARLRIYNETSQPLEEYYRTKG 249

  Fly   190 LVATFK---GKQTKEIWPMM--ELFLND 212
            .:..|.   |  ..|.||.:  .|.|:|
plant   250 KLMEFDLPGG--IPESWPRLLEALRLDD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 70/220 (32%)
ADK 7..201 CDD:238713 66/208 (32%)
ADKNP_181262.1 PLN02459 25..284 CDD:215253 72/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.