DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Ak7

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_084463.1 Gene:Ak7 / 78801 MGIID:1926051 Length:723 Species:Mus musculus


Alignment Length:171 Identity:42/171 - (24%)
Similarity:64/171 - (37%) Gaps:60/171 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIK------------------------NTEL 50
            |:|.|..||.:|||.:.|.:...||...|::.:.|.|                        |.:.
Mouse   372 ILGPPAVGKSSISEELAKYYKLHHIKMKDVIAEAIAKLEAIVAPKDSVEGEEEGEEEEEEENVDD 436

  Fly    51 GKKAKQYIAE------GKLVPDAIV------TKTMLARITEVGNRSYILDGFPRNIAQAEALAAR 103
            .::....|.|      |:|....|:      .|:|..|     |:.:||||||:...||:.|..:
Mouse   437 AQELLDGIKESMEQNAGRLEDQYIIRFVKEKLKSMPCR-----NQGFILDGFPKTYDQAKDLFNQ 496

  Fly   104 EQ-------------IDAVIT------LDVPHSVIIDRVKN 125
            |:             .|.:||      ||.....:.:||.|
Mouse   497 EEEEEEEEIRGKIFPYDKLITPEFVCGLDASDEFLKERVMN 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 42/171 (25%)
ADK 7..201 CDD:238713 42/171 (25%)
Ak7NP_084463.1 WcaG <147..297 CDD:223528
NADB_Rossmann <218..298 CDD:304358
ADK 369..>548 CDD:238713 42/171 (25%)
Dpy-30 679..720 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.