DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and cmpk1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001263603.1 Gene:cmpk1 / 733534 XenbaseID:XB-GENE-980040 Length:219 Species:Xenopus tropicalis


Alignment Length:199 Identity:57/199 - (28%)
Similarity:91/199 - (45%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIK-NTELGKKAKQYIAEGKLVPDA 67
            |.|...::|.||:||||..|.|.:.:|..|:|.||:||....| :::.|:..:.||.:|::|| .
 Frog    25 KPFVVFVLGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPDSQYGELIESYIRDGRIVP-V 88

  Fly    68 IVTKTMLARITEV-----GNR-SYILDGFPRNIAQAE----ALAAREQIDAVITLDVPHSVIIDR 122
            .:|.::|.|..|.     ||: .:::||||||....:    .:..:..:..|:..|..:...|:|
 Frog    89 EITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIER 153

  Fly   123 VKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEK 187
            ...|                    ||..       .|.||....:.||::.|.:...|:|..|||
 Frog   154 CLER--------------------GKSS-------GRSDDNRESLEKRIQTYLQSTRPIIDLYEK 191

  Fly   188 KGLV 191
            .|.|
 Frog   192 TGKV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 55/196 (28%)
ADK 7..201 CDD:238713 55/196 (28%)
cmpk1NP_001263603.1 UMP_CMP_kin_fam 28..216 CDD:273576 55/196 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.