Sequence 1: | NP_001287279.1 | Gene: | Adk3 / 41318 | FlyBaseID: | FBgn0042094 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079923.3 | Gene: | Cmpk1 / 66588 | MGIID: | 1913838 | Length: | 227 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 54/196 - (27%) |
---|---|---|---|
Similarity: | 87/196 - (44%) | Gaps: | 45/196 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKN--TELGKKAKQYIAEGKLVPDAI---- 68
Fly 69 ----VTKTMLARITEVGNRSYILDGFPRNIAQAE----ALAAREQIDAVITLDVPHSVIIDRVKN 125
Fly 126 RWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGL 190
Fly 191 V 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk3 | NP_001287279.1 | adk | 7..211 | CDD:273569 | 54/196 (28%) |
ADK | 7..201 | CDD:238713 | 54/196 (28%) | ||
Cmpk1 | NP_079923.3 | UMP_CMP_kin_fam | 36..224 | CDD:273576 | 54/196 (28%) |
ADK | 36..215 | CDD:238713 | 54/196 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |