DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and AT3G60961

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001118870.1 Gene:AT3G60961 / 6241017 AraportID:AT3G60961 Length:136 Species:Arabidopsis thaliana


Alignment Length:163 Identity:42/163 - (25%)
Similarity:70/163 - (42%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IAEGKLVPDAIVTKTMLARITE----VGNRSYILDGFPRNIAQAEAL--AAREQIDAVITLDVPH 116
            ||||::||..|..|.:...:.|    .||..:::||||||.......  .||.:...|:..|.|.
plant     2 IAEGRIVPSEITVKLLCKAMEESFQVSGNDKFLIDGFPRNEENRIVFENVARIEPAFVLFFDCPE 66

  Fly   117 SVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPV 181
            ..:..|:.:|          |.|                   ||||....:.||.:::.|...|:
plant    67 EELERRIMSR----------NQG-------------------REDDNIETIKKRFKVFVESTLPI 102

  Fly   182 IAWYEKKGLVATFK-GKQTKEIWPMME-LFLND 212
            |::|:.||.:.... .|.::|::..:. ||.::
plant   103 ISYYQSKGKLRKINAAKSSEEVFEAVRVLFASE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 42/160 (26%)
ADK 7..201 CDD:238713 39/149 (26%)
AT3G60961NP_001118870.1 ADK <1..124 CDD:238713 39/150 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.