DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Ak3

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_006527285.1 Gene:Ak3 / 56248 MGIID:1860835 Length:263 Species:Mus musculus


Alignment Length:184 Identity:98/184 - (53%)
Similarity:130/184 - (70%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAI 68
            ::.||||:|||||||||:|..|.|:....|:|:||:||||:::.||:|..||.:|.:|||:||.:
Mouse     6 RLLRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFIDQGKLIPDDV 70

  Fly    69 VTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSG 133
            :|:..|..:..:...|::||||||.:.|||||....|||.||.|:||..||..|:..||||..||
Mouse    71 MTRLALHELKTLTQCSWLLDGFPRTLPQAEALDKVYQIDTVINLNVPFEVIKQRLTARWIHPASG 135

  Fly   134 RVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEK 187
            |||||.|..||..|.||:|||||:|||||||..|.|||:.|:....||:.:|:|
Mouse   136 RVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 98/181 (54%)
ADK 7..201 CDD:238713 98/181 (54%)
Ak3XP_006527285.1 ADK 12..189 CDD:366082 94/176 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837176
Domainoid 1 1.000 198 1.000 Domainoid score I3081
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H21744
Inparanoid 1 1.050 226 1.000 Inparanoid score I3474
Isobase 1 0.950 - 0 Normalized mean entropy S722
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 1 1.000 - - FOG0003066
OrthoInspector 1 1.000 - - otm42938
orthoMCL 1 0.900 - - OOG6_103907
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2169
SonicParanoid 1 1.000 - - X2043
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.