Sequence 1: | NP_001287279.1 | Gene: | Adk3 / 41318 | FlyBaseID: | FBgn0042094 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018480.1 | Gene: | ak8 / 553671 | ZFINID: | ZDB-GENE-050522-275 | Length: | 486 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 47/200 - (23%) |
---|---|---|---|
Similarity: | 91/200 - (45%) | Gaps: | 36/200 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTK 71
Fly 72 TMLARITEVG--NRSYILDGFPRNIAQAEAL-AAREQIDAVITLDVPHSVIIDRVKNRWIHAPSG 133
Fly 134 RVYNIGFKNPKVPGKD----------DVTGEPLMQ---------------------REDDKPHVV 167
Fly 168 AKRLE 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk3 | NP_001287279.1 | adk | 7..211 | CDD:273569 | 46/199 (23%) |
ADK | 7..201 | CDD:238713 | 46/199 (23%) | ||
ak8 | NP_001018480.1 | Adenylate kinase 1. /evidence=ECO:0000250|UniProtKB:Q96MA6 | 58..258 | ||
adk | 59..257 | CDD:273569 | |||
ADK | 59..245 | CDD:238713 | |||
NMP 1. /evidence=ECO:0000250|UniProtKB:P69441 | 87..112 | ||||
LID 1. /evidence=ECO:0000250|UniProtKB:P69441 | 176..205 | ||||
Adenylate kinase 2. /evidence=ECO:0000250|UniProtKB:Q96MA6 | 269..471 | 46/199 (23%) | |||
adk | 270..470 | CDD:273569 | 46/199 (23%) | ||
ADK | 270..462 | CDD:238713 | 44/193 (23%) | ||
NMP 2. /evidence=ECO:0000250|UniProtKB:P69441 | 298..327 | 5/28 (18%) | |||
LID 2. /evidence=ECO:0000250|UniProtKB:P69441 | 391..424 | 7/34 (21%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |