DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ak7b

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001103168.2 Gene:ak7b / 504040 ZFINID:ZDB-GENE-050309-170 Length:699 Species:Danio rerio


Alignment Length:219 Identity:54/219 - (24%)
Similarity:87/219 - (39%) Gaps:71/219 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAVIIGAPGSGKGTISELICKNHGCVHIST------------------------------GDILR 41
            |..|:|.|..||.||:|.|||::...||..                              .|.||
Zfish   363 RMCIVGPPAVGKSTIAEKICKHYNLHHIKLKEAIAEALENLELCVRTEDEENDQDDDQEFWDTLR 427

  Fly    42 QNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEAL----AA 102
            :|:.:|.  |:...||:.  :::.|.:.||..:       |:.::|||||:...||:.|    ..
Zfish   428 ENMNENG--GRLDDQYVI--RIMKDKLRTKPCM-------NQGFVLDGFPKTCEQAKELFTGDGE 481

  Fly   103 REQIDAV-ITLDVPHSVII-----DRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQR-- 159
            .|.:::. .|..:|..|..     |.:|||.::.|...|....:    :|       |..:||  
Zfish   482 PEDLESKHATKIIPEFVFSVNATDDFLKNRVLNLPETVVEGTSY----MP-------EQFLQRLA 535

  Fly   160 -------EDDKPHVVAKRLELYDE 176
                   ||:.|....:.||::.|
Zfish   536 RFRDRNVEDEMPLNYFEDLEIHPE 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 54/219 (25%)
ADK 7..201 CDD:238713 54/219 (25%)
ak7bNP_001103168.2 WcaG <129..>286 CDD:223528
NADB_Rossmann <212..286 CDD:304358
Adk 363..583 CDD:223637 54/219 (25%)
ADK 363..556 CDD:238713 52/214 (24%)
Dpy-30 656..697 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.