DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ak1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_031746217.1 Gene:ak1 / 448536 XenbaseID:XB-GENE-1012039 Length:566 Species:Xenopus tropicalis


Alignment Length:184 Identity:59/184 - (32%)
Similarity:90/184 - (48%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVP-DAIVTKTM 73
            ::|.|||||||..|.|...:|..|:||||:||..:...:|.||.....:.:|:||| |.::....
 Frog   385 VVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSSGSERGKHLSAIMEKGELVPLDTVLDMLK 449

  Fly    74 LARITEVG-NRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYN 137
            .|.|.:.. ::.|::||:||.:.|.|..  .::|.       |.|:::      :|.|.|..:..
 Frog   450 EAMIAKADTSKGYLIDGYPREVKQGEEF--EKKIG-------PPSLLL------YIDAGSDTMVK 499

  Fly   138 IGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLV 191
            ...|..:..|           |.||....:.||||.|.:...||||.||.:|:|
 Frog   500 RLLKRGETSG-----------RADDNEATIKKRLETYYKATEPVIAMYEGRGIV 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 59/184 (32%)
ADK 7..201 CDD:238713 59/184 (32%)
ak1XP_031746217.1 aden_kin_iso1 129..312 CDD:130427
aden_kin_iso1 378..565 CDD:130427 59/184 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.