DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ak1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_005168739.1 Gene:ak1 / 445486 ZFINID:ZDB-GENE-040822-37 Length:209 Species:Danio rerio


Alignment Length:210 Identity:60/210 - (28%)
Similarity:101/210 - (48%) Gaps:49/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVP--------- 65
            ::|.|||||||..|.|...:|..|:|:||:||..:...:|.||:.:..:.:|:|||         
Zfish    28 VVGGPGSGKGTQCEKIVAKYGYTHLSSGDLLRAEVASGSERGKQLQAIMQKGELVPLDTVLDMIK 92

  Fly    66 DAIVTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVIT-LDVPHSVIIDRVKNRWIH 129
            ||::.|..:       ::.|::||:||.:.|.|....:....|::. :|.....::.|:..|   
Zfish    93 DAMIAKADV-------SKGYLIDGYPREVKQGEEFEKKIGAPALLLYIDAKGETMVKRLMKR--- 147

  Fly   130 APSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATF 194
                               .:.:|     |.||....:.|||:||.:...||||:||::|:|.  
Zfish   148 -------------------GETSG-----RADDNEETIKKRLDLYYKATEPVIAFYEQRGIVR-- 186

  Fly   195 KGKQTKEIWPMMELF 209
              |...|: |:.|:|
Zfish   187 --KINSEL-PVDEVF 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 60/210 (29%)
ADK 7..201 CDD:238713 56/200 (28%)
ak1XP_005168739.1 aden_kin_iso1 21..208 CDD:130427 60/210 (29%)
ADK 25..197 CDD:238713 58/207 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.