DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Dak1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster


Alignment Length:187 Identity:46/187 - (24%)
Similarity:75/187 - (40%) Gaps:31/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIK-NTELGKKAKQYIAEGKLVPDAIVTKTM 73
            ::|.||:||||....|.......|:|.||:||:...: .:|.|...:.||..||:||..:....:
  Fly    68 VLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLL 132

  Fly    74 LARITEVGNRSYILDGFPRNIAQAEA----LAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGR 134
            ...:...|...:::||||||....:.    ::.:.....|:..|....|.:.|...|        
  Fly   133 ENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGR-------- 189

  Fly   135 VYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLV 191
                              |:....|.||....:.||:..|:....|:|.::|..|.|
  Fly   190 ------------------GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 46/187 (25%)
ADK 7..201 CDD:238713 46/187 (25%)
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 46/187 (25%)
ADK 65..240 CDD:238713 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451283
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.