DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ak3

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_998295.2 Gene:ak3 / 406404 ZFINID:ZDB-GENE-040426-2142 Length:225 Species:Danio rerio


Alignment Length:210 Identity:106/210 - (50%)
Similarity:149/210 - (70%) Gaps:0/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIV 69
            :|||||:|||||||||:|..|.::.|..|:|:||:||.||...|:||...|..|.:|:||||.::
Zfish     6 VFRAVIMGAPGSGKGTVSSRIAQSFGLKHLSSGDMLRANIEAKTDLGLLMKSCIDQGQLVPDDVI 70

  Fly    70 TKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGR 134
            ::.:|:.:..:...|::||||||.:||||||.....:|:||.||||...|.:|:.:||:|.||||
Zfish    71 SRLILSSLRGLEKTSWLLDGFPRTVAQAEALDCVYDVDSVINLDVPFQTIRERLTSRWVHLPSGR 135

  Fly   135 VYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQT 199
            ||||.|..||.||.||||||||:||:||.|..|::||:.|:....||:.:|..||::.||.|.:|
Zfish   136 VYNIDFNPPKKPGLDDVTGEPLVQRDDDSPETVSRRLKDYERQTQPVLEYYRSKGVLETFSGTET 200

  Fly   200 KEIWPMMELFLNDRI 214
            .:|||.:..||:.:|
Zfish   201 NKIWPHVHTFLSRKI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 103/203 (51%)
ADK 7..201 CDD:238713 99/193 (51%)
ak3NP_998295.2 ADK 8..200 CDD:238713 98/191 (51%)
adk 8..198 CDD:234711 97/189 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580756
Domainoid 1 1.000 195 1.000 Domainoid score I3102
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H21744
Inparanoid 1 1.050 227 1.000 Inparanoid score I3455
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 1 1.000 - - FOG0003066
OrthoInspector 1 1.000 - - otm24331
orthoMCL 1 0.900 - - OOG6_103907
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2169
SonicParanoid 1 1.000 - - X2043
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.