DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ak7a

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001166036.1 Gene:ak7a / 402854 ZFINID:ZDB-GENE-040724-122 Length:696 Species:Danio rerio


Alignment Length:157 Identity:29/157 - (18%)
Similarity:64/157 - (40%) Gaps:41/157 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNI-------------IKNTELGKKAKQ----- 56
            ::|.|..||.|::|.:||.:...|::..:.:.:.|             .:|.||...|::     
Zfish   361 LLGPPAVGKSTVAEELCKYYKLNHVTVDEAVSEKIRQLEELLERNEKTAENEELLSAAEEKLKAI 425

  Fly    57 ---YIAEGKLVPDAIVTKTMLARITEV--GNRSYILDGFPRNIAQAEALAAREQIDA-------- 108
               .:..|..:.:..:...::.::..:  .|:.::|||:|:..:||..|...|.::.        
Zfish   426 KNSMLQNGGQLDNQQIIHIIMEKLNSMPCRNQGFVLDGYPKTYSQANELFQDENMEVEDGRATEP 490

  Fly   109 ----------VITLDVPHSVIIDRVKN 125
                      |.:||.....:..||::
Zfish   491 KYNKVMIPEFVFSLDATDDFLKARVRS 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 29/157 (18%)
ADK 7..201 CDD:238713 29/157 (18%)
ak7aNP_001166036.1 NADB_Rossmann <162..288 CDD:304358
WcaG <208..288 CDD:223528
ADK 358..568 CDD:238713 29/157 (18%)
Dpy-30 653..694 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.