DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Adk1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster


Alignment Length:184 Identity:43/184 - (23%)
Similarity:78/184 - (42%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTML 74
            |:|.||.||||....|.:.:|..|:|:||:||..:...::.|::.:..:|.|.||.:..|...:.
  Fly    37 ILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLN 101

  Fly    75 ARITEV--GNRSYILDGFPRNIAQAEALAAR-EQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVY 136
            ..||..  .::.:::||:||...|.....|| ...|..:..:.....::.|:..|          
  Fly   102 DAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMAR---------- 156

  Fly   137 NIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGL 190
                           .....::|:||....:..||..:.:..:.::..||.|.|
  Fly   157 ---------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 43/184 (23%)
ADK 7..201 CDD:238713 43/184 (23%)
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 43/184 (23%)
ADK 34..206 CDD:238713 43/184 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451285
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.