DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Adk2

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster


Alignment Length:211 Identity:82/211 - (38%)
Similarity:124/211 - (58%) Gaps:15/211 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AVIIGAPGSGKGTISELICKNHGCV-HISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTK 71
            |:::|.|||||||.:.|: |...|| |:||||:||..|...::||.:.|:.:..||||.|.:|..
  Fly    21 AILLGPPGSGKGTQAPLL-KEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVD 84

  Fly    72 TMLARI--TEVGNRSYILDGFPRNIAQAEAL-----AAREQIDAVITLDVPHSVIIDRVKNRWIH 129
            .:.:.:  .|..| .::||||||.:.|||.|     ..:..:||||...:..|:::.|:..|.||
  Fly    85 MIDSNLDKPECKN-GFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIH 148

  Fly   130 APSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATF 194
            ..|||.|:..|..||.|..||||||||::|.||....:.||||.|.:...|::.:|..:||  .|
  Fly   149 QASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGL--HF 211

  Fly   195 K---GKQTKEIWPMME 207
            |   .|::.:::..::
  Fly   212 KVDAAKKSSDVFSTID 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 82/211 (39%)
ADK 7..201 CDD:238713 82/203 (40%)
Adk2NP_523836.2 adk 20..233 CDD:234711 82/211 (39%)
ADK 20..222 CDD:238713 82/204 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451286
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.