DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and CG9541

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster


Alignment Length:181 Identity:46/181 - (25%)
Similarity:76/181 - (41%) Gaps:46/181 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTIS-ELICKNHGCVHISTGDILRQNII-----KNTELGKKAKQYIAEGKLVPDAI 68
            :||.|||.|.|:. :.:..|.|..|||.|.:|| ||.     .||| ....|:.:|.|.:.|:..
  Fly   362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLR-NITDSAPRANTE-SFAVKEALAAGDMAPEKS 424

  Fly    69 VTKTMLARITEVGNRS-YILDGFPRNIAQAEALAAR-EQIDAVITLDVPHSVIIDRVKNRWIHAP 131
            :.:.:...:.::.:|: .|:||:|||:.|.:....: :|...:|.||...           :...
  Fly   425 LNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSK-----------LQLG 478

  Fly   132 SGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVI 182
            .||:                         ||......:||||:.|...|::
  Fly   479 RGRI-------------------------DDTVSSFRRRLELFREQTLPML 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 46/181 (25%)
ADK 7..201 CDD:238713 46/181 (25%)
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 46/181 (25%)
ADK 359..521 CDD:238713 46/181 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451280
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.