Sequence 1: | NP_001287279.1 | Gene: | Adk3 / 41318 | FlyBaseID: | FBgn0042094 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997761.1 | Gene: | ak2 / 321793 | ZFINID: | ZDB-GENE-030131-512 | Length: | 241 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 77/205 - (37%) |
---|---|---|---|
Similarity: | 119/205 - (58%) | Gaps: | 6/205 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAI 68
Fly 69 VTKTMLARI-TEVGNRSYILDGFPRNIAQAEAL-----AAREQIDAVITLDVPHSVIIDRVKNRW 127
Fly 128 IHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVA 192
Fly 193 TFKGKQTKEI 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk3 | NP_001287279.1 | adk | 7..211 | CDD:273569 | 76/202 (38%) |
ADK | 7..201 | CDD:238713 | 76/199 (38%) | ||
ak2 | NP_997761.1 | adk | 19..231 | CDD:234711 | 76/202 (38%) |
ADK | 19..221 | CDD:238713 | 76/202 (38%) | ||
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 | 47..76 | 11/28 (39%) | |||
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 | 143..180 | 21/36 (58%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 152..180 | 15/27 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53706 | |
OrthoDB | 1 | 1.010 | - | - | D1004067at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.830 |