DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Ak8

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001004266.1 Gene:Ak8 / 311833 RGDID:1303144 Length:479 Species:Rattus norvegicus


Alignment Length:215 Identity:58/215 - (26%)
Similarity:100/215 - (46%) Gaps:35/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKN--TELGKKAKQYIAEGKLVPDAIV 69
            |.||:|.|.|||.||:..:||     |:::..|.::|:::.  :.|..:||::....|.||::.:
  Rat    59 RVVILGPPASGKTTIAMWLCK-----HLNSNLITKENLLEREFSLLSLEAKKHYQVYKRVPNSTL 118

  Fly    70 TKTMLARITEVG--NRSYILDGFPRN-----IAQAEALAAREQIDAVITLDVPHSVIIDRVKNRW 127
            ...:..|:.|..  .|.:||||.|..     :.|...||.:.    ||.|..|.||:|:|...:.
  Rat   119 VSLVQERLNEDDCLRRGWILDGIPERREQALMIQTLGLAPKH----VIVLSAPDSVLIERNVGKR 179

  Fly   128 IHAPSGRVYNIGFKNP---KVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKG 189
            |...:|.:|:..|..|   ::..:       |:|.|.......||:|..|...:..::..|.|  
  Rat   180 IDPVTGEIYHTTFDWPPELEIQNR-------LIQPEGISEIDTAKKLLEYHRHIIRILPSYPK-- 235

  Fly   190 LVATFKGKQTKEIWPMMELF 209
            ::.|....|     |.:::|
  Rat   236 ILKTISSDQ-----PCVDVF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 58/215 (27%)
ADK 7..201 CDD:238713 56/205 (27%)
Ak8NP_001004266.1 Adenylate kinase 1. /evidence=ECO:0000250|UniProtKB:Q96MA6 58..258 58/215 (27%)
adk 59..258 CDD:273569 58/215 (27%)
ADK 59..249 CDD:238713 57/212 (27%)
NMP 1. /evidence=ECO:0000250|UniProtKB:P69441 87..113 5/25 (20%)
LID 1. /evidence=ECO:0000250|UniProtKB:P69441 177..206 6/35 (17%)
Adenylate kinase 2. /evidence=ECO:0000250|UniProtKB:Q96MA6 269..471
adk 270..468 CDD:273569
ADK 270..462 CDD:238713
NMP 2. /evidence=ECO:0000250|UniProtKB:P69441 298..327
LID 2. /evidence=ECO:0000250|UniProtKB:P69441 391..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.