DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and LOC301115

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_017452195.2 Gene:LOC301115 / 301115 RGDID:1588584 Length:212 Species:Rattus norvegicus


Alignment Length:186 Identity:48/186 - (25%)
Similarity:86/186 - (46%) Gaps:32/186 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTML 74
            ::|.||.||||....:...:|..|:..|.:||:...::|:.|::.:..:.:|.|||..::...:.
  Rat    31 VVGGPGCGKGTQCRNMAMKYGFYHVELGQLLREEAQRSTQRGRQIRDIMQQGLLVPTGLILDMVS 95

  Fly    75 ARITEV-GNRSYILDGFPRNIAQA---EALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRV 135
            ..:... .:|.:::|||||.:.||   |.:..|.. :.||..|.....::.||..|      |:|
  Rat    96 DNLLSYPKSRGFLVDGFPRELEQAKEFERIVGRAP-NIVIVFDCSMETMVRRVLRR------GQV 153

  Fly   136 YNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLV 191
            .:                     |.||....:.||||.:..:..||:.:|::|.|:
  Rat   154 EH---------------------RADDSELAIRKRLETHYTLCEPVLTFYQQKNLL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 48/186 (26%)
ADK 7..201 CDD:238713 48/186 (26%)
LOC301115XP_017452195.2 aden_kin_iso1 28..211 CDD:130427 48/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.