DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Cmpk1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001020826.1 Gene:Cmpk1 / 298410 RGDID:1310116 Length:227 Species:Rattus norvegicus


Alignment Length:216 Identity:59/216 - (27%)
Similarity:96/216 - (44%) Gaps:47/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKN--TELGKKAKQYIAEGKLVPDAI---- 68
            ::|.||:||||....|.:.:|..|:|.|::||.. .||  ::.|:..::||.|||:||..|    
  Rat    39 VLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDE-RKNPDSQYGELIEKYIKEGKIVPVEITISL 102

  Fly    69 ----VTKTMLARITEVGNRSYILDGFPRNIAQAE----ALAAREQIDAVITLDVPHSVIIDRVKN 125
                :.:||.|...:   ..:::||||||....:    .:..:..:..|:..|..:.:.|||...
  Rat   103 LKREMDQTMAANAQK---NKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIDRCLE 164

  Fly   126 RWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGL 190
            |                    ||..       .|.||....:.||::.|.|...|:|..||:.|.
  Rat   165 R--------------------GKSS-------GRSDDNRESLEKRIQTYLESTKPIIDLYEEMGK 202

  Fly   191 VATF-KGKQTKEIW-PMMELF 209
            |... ..|...|:: .:|::|
  Rat   203 VKKIDASKSVDEVFGDVMKIF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 59/216 (27%)
ADK 7..201 CDD:238713 56/205 (27%)
Cmpk1NP_001020826.1 UMP_CMP_kin_fam 36..224 CDD:273576 59/216 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.