DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Ak3

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_037350.2 Gene:Ak3 / 26956 RGDID:619885 Length:227 Species:Rattus norvegicus


Alignment Length:211 Identity:109/211 - (51%)
Similarity:148/211 - (70%) Gaps:0/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAI 68
            ::.||||:|||||||||:|..|.|:....|:|:||:||||:::.||:|..||.:|.:|||:||.:
  Rat     6 RLLRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFIDQGKLIPDDV 70

  Fly    69 VTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSG 133
            :|:..|..:..:...|::||||||.:.|||||....|||.||.|:||..||..|:..||||..||
  Rat    71 MTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEVIKLRLTARWIHPASG 135

  Fly   134 RVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQ 198
            |||||.|..||..|.||:|||||:|||||||..|.|||:.|:....||:.:|:|||::.||.|.:
  Rat   136 RVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQKKGVLETFSGTE 200

  Fly   199 TKEIWPMMELFLNDRI 214
            |.:|||.:..||..::
  Rat   201 TNKIWPHVYSFLQMKV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 108/203 (53%)
ADK 7..201 CDD:238713 104/193 (54%)
Ak3NP_037350.2 ADK 12..190 CDD:395329 94/177 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340893
Domainoid 1 1.000 190 1.000 Domainoid score I3172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H21744
Inparanoid 1 1.050 216 1.000 Inparanoid score I3516
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 1 1.000 - - FOG0003066
OrthoInspector 1 1.000 - - otm45007
orthoMCL 1 0.900 - - OOG6_103907
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2043
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.