DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and SPCC1795.05c

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001342723.1 Gene:SPCC1795.05c / 2538942 PomBaseID:SPCC1795.05c Length:191 Species:Schizosaccharomyces pombe


Alignment Length:217 Identity:54/217 - (24%)
Similarity:84/217 - (38%) Gaps:62/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFTKIFRAVIIGAPGSGKGT-ISELICKNHGCVHISTGDILRQNIIK-NTELGKKAKQYIAEGKL 63
            |:..||   ::|.||:|||| ...|..|....||||.||.||:...: .::.|...|:||.:||:
pombe     1 MYNVIF---VLGGPGAGKGTQCDRLAEKFDKFVHISAGDCLREEQNRPGSKYGNLIKEYIKDGKI 62

  Fly    64 VPDAI---VTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKN 125
            ||..|   :.:|.:....:.|...:::|||||.:.|.|                           
pombe    63 VPMEITISLLETKMKECHDKGIDKFLIDGFPREMDQCE--------------------------- 100

  Fly   126 RWIHAPSGRVYNIGFKNPKVPGKDDV---TGEPLM-----------QREDDKPHVVAKRLELYDE 176
                         ||:....|.|..:   .|:..|           .|.||....:.||...|.:
pombe   101 -------------GFEKSVCPAKFALYFRCGQETMLKRLIHRGKTSGRSDDNIESIKKRFVTYTK 152

  Fly   177 VMSPVIAWYEKKGLVATFKGKQ 198
            ...||:.:.:.:..:.|...:|
pombe   153 ASMPVVEYLKSQNRLITIDAEQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 51/211 (24%)
ADK 7..201 CDD:238713 51/211 (24%)
SPCC1795.05cNP_001342723.1 ADK 4..187 CDD:331878 53/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.