DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Ak2

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_112248.2 Gene:Ak2 / 24184 RGDID:2077 Length:239 Species:Rattus norvegicus


Alignment Length:205 Identity:79/205 - (38%)
Similarity:119/205 - (58%) Gaps:6/205 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAI 68
            |..|||::|.||:||||.:..:.:|....|::|||:||..:...:|||||.|..:..||||.|.:
  Rat    14 KGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEM 78

  Fly    69 VTKTMLARI-TEVGNRSYILDGFPRNIAQAEAL-----AAREQIDAVITLDVPHSVIIDRVKNRW 127
            |.:.:...: |......::||||||.:.|||.|     ..:|::|:||...:..|::|.|:..|.
  Rat    79 VVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKEKLDSVIEFSIQDSLLIRRITGRL 143

  Fly   128 IHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVA 192
            ||..|||.|:..|..||...|||:|||||::|.||....:..|||.|....:|::.:|.|:|:..
  Rat   144 IHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHC 208

  Fly   193 TFKGKQTKEI 202
            .....||.::
  Rat   209 AIDASQTPDV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 78/202 (39%)
ADK 7..201 CDD:238713 78/199 (39%)
Ak2NP_112248.2 adk 17..229 CDD:234711 78/202 (39%)
ADK 17..219 CDD:238713 78/202 (39%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 45..74 13/28 (46%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 141..178 19/36 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.