DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and F38B2.4

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001257141.1 Gene:F38B2.4 / 181317 WormBaseID:WBGene00009531 Length:210 Species:Caenorhabditis elegans


Alignment Length:184 Identity:51/184 - (27%)
Similarity:85/184 - (46%) Gaps:31/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIV---TK 71
            |:|.|||||||..:.|...:|..|:|:||:||..:...:..|.:....:..|.|||..:|   .|
 Worm    25 IVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPLEVVLDLVK 89

  Fly    72 TMLARITEVGNRSYILDGFPRNIAQAEALAAR-EQIDAVITLDVPHSVIIDRVKNRWIHAPSGRV 135
            ..:.:..|.|::.:::||:||.:||.:...:. ::...|:..||....::.|:.:|  ...|||.
 Worm    90 EAMLKAIEKGSKGFLIDGYPREVAQGQQFESEIQEAKLVLFFDVAEETLVKRLLHR--AQTSGRA 152

  Fly   136 YNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKG 189
                                     ||....:.|||..:....:||:.:||.||
 Worm   153 -------------------------DDNADTIKKRLHTFVTSTAPVVDYYESKG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 51/184 (28%)
ADK 7..201 CDD:238713 51/184 (28%)
F38B2.4NP_001257141.1 aden_kin_iso1 18..206 CDD:130427 51/184 (28%)
ADK 22..195 CDD:238713 51/184 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.