Sequence 1: | NP_001287279.1 | Gene: | Adk3 / 41318 | FlyBaseID: | FBgn0042094 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509786.2 | Gene: | F13E6.2 / 181264 | WormBaseID: | WBGene00008746 | Length: | 729 | Species: | Caenorhabditis elegans |
Alignment Length: | 217 | Identity: | 48/217 - (22%) |
---|---|---|---|
Similarity: | 92/217 - (42%) | Gaps: | 40/217 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 VIIGAPGSGKGTISELICKNH-GCVHISTGDILRQNI--IKNTELGKKAKQYIAEGKLVPDAIVT 70
Fly 71 KTMLARITEVG--NRSYILDGFPRNIAQAEALA-AREQIDAVITLDVPHSVIIDRVKNRWIHAPS 132
Fly 133 GRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGK 197
Fly 198 QT-----KEIWPMME--LFLND 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk3 | NP_001287279.1 | adk | 7..211 | CDD:273569 | 47/214 (22%) |
ADK | 7..201 | CDD:238713 | 44/202 (22%) | ||
F13E6.2 | NP_509786.2 | aden_kin_iso1 | 168..355 | CDD:130427 | |
ADK | 171..337 | CDD:238713 | |||
aden_kin_iso1 | 514..699 | CDD:130427 | 46/208 (22%) | ||
ADK | 515..690 | CDD:238713 | 44/199 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |