DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and AK8

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_005272226.1 Gene:AK8 / 158067 HGNCID:26526 Length:491 Species:Homo sapiens


Alignment Length:225 Identity:61/225 - (27%)
Similarity:102/225 - (45%) Gaps:33/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKN--TELGKKAKQYIAEGKLVPDAIV 69
            |.||:|.|.|||.||:..:||     |:::..:..:|:|.|  :....:|::...:.|.||.|::
Human    71 RIVILGPPASGKTTIAMWLCK-----HLNSSLLTLENLILNEFSYTATEARRLYLQRKTVPSALL 130

  Fly    70 TKTMLARITEVG--NRSYILDGFPRNIAQA---EALAAREQIDAVITLDVPHSVIIDRVKNRWIH 129
            .:.:..|:.|..  .:.:||||.|....||   :.|....:  .||.|..|.:|:|:|...:.|.
Human   131 VQLIQERLAEEDCIKQGWILDGIPETREQALRIQTLGITPR--HVIVLSAPDTVLIERNLGKRID 193

  Fly   130 APSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATF 194
            ..:|.:|:..|   ..|.:.::... ||..||......|::|..|...:..||..|.|  ::...
Human   194 PQTGEIYHTTF---DWPPESEIQNR-LMVPEDISELETAQKLLEYHRNIVRVIPSYPK--ILKVI 252

  Fly   195 KGKQTKEIWPMMELFL--------NDRINA 216
            ...|     |.:::|.        |.|.||
Human   253 SADQ-----PCVDVFYQALTYVQSNHRTNA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 57/218 (26%)
ADK 7..201 CDD:238713 55/200 (28%)
AK8XP_005272226.1 adk 71..270 CDD:273569 57/216 (26%)
ADK 71..261 CDD:238713 56/207 (27%)
adk 282..480 CDD:273569
ADK 282..474 CDD:238713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.