Sequence 1: | NP_001287279.1 | Gene: | Adk3 / 41318 | FlyBaseID: | FBgn0042094 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001029138.1 | Gene: | Ak2 / 11637 | MGIID: | 87978 | Length: | 239 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 81/205 - (39%) |
---|---|---|---|
Similarity: | 120/205 - (58%) | Gaps: | 6/205 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAI 68
Fly 69 VTKTMLARI-TEVGNRSYILDGFPRNIAQAEAL-----AAREQIDAVITLDVPHSVIIDRVKNRW 127
Fly 128 IHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVA 192
Fly 193 TFKGKQTKEI 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk3 | NP_001287279.1 | adk | 7..211 | CDD:273569 | 80/202 (40%) |
ADK | 7..201 | CDD:238713 | 79/199 (40%) | ||
Ak2 | NP_001029138.1 | ADK | 17..219 | CDD:238713 | 80/202 (40%) |
ADK | 20..204 | CDD:278818 | 72/183 (39%) | ||
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 | 45..74 | 13/28 (46%) | |||
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 | 141..178 | 20/36 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53706 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |