DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Ak2

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001029138.1 Gene:Ak2 / 11637 MGIID:87978 Length:239 Species:Mus musculus


Alignment Length:205 Identity:81/205 - (39%)
Similarity:120/205 - (58%) Gaps:6/205 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAI 68
            |..|||::|.||:||||.:..:.:|....|::|||:||..:...:|||||.|..:..||||.|.:
Mouse    14 KGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEM 78

  Fly    69 VTKTMLARI-TEVGNRSYILDGFPRNIAQAEAL-----AAREQIDAVITLDVPHSVIIDRVKNRW 127
            |.:.:...: |......::||||||.:.|||.|     ..:|::|:||...:..|::|.|:..|.
Mouse    79 VVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRL 143

  Fly   128 IHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVA 192
            ||..|||.|:..|..||.|.|||:|||||::|.||....:..|||.|....:|::.:|.|:|:..
Mouse   144 IHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHC 208

  Fly   193 TFKGKQTKEI 202
            .....||.:|
Mouse   209 AIDASQTPDI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 80/202 (40%)
ADK 7..201 CDD:238713 79/199 (40%)
Ak2NP_001029138.1 ADK 17..219 CDD:238713 80/202 (40%)
ADK 20..204 CDD:278818 72/183 (39%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 45..74 13/28 (46%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 141..178 20/36 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.