DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and Ak1

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_067490.1 Gene:Ak1 / 11636 MGIID:87977 Length:210 Species:Mus musculus


Alignment Length:195 Identity:59/195 - (30%)
Similarity:93/195 - (47%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVP-DAI---VT 70
            ::|.|||||||..|.|.:.:|..|:||||:||..:...:|.|||....:.:|:||| |.:   :.
Mouse    29 VVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLR 93

  Fly    71 KTMLARITEVGNRSYILDGFPRNIAQAEALAAR-EQIDAVITLDVPHSVIIDRVKNRWIHAPSGR 134
            ..|||::.  .:..:::||:||.:.|.|....: .|...::.:|.....:..|:..|  ...|||
Mouse    94 DAMLAKVD--SSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKR--GETSGR 154

  Fly   135 VYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQT 199
            |                         ||....:.||||.|.....|||::|:|:|:|.....:.|
Mouse   155 V-------------------------DDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGT 194

  Fly   200  199
            Mouse   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 59/195 (30%)
ADK 7..201 CDD:238713 59/195 (30%)
Ak1NP_067490.1 aden_kin_iso1 22..209 CDD:130427 59/195 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.