DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ak3

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_012812420.1 Gene:ak3 / 100170447 XenbaseID:XB-GENE-977028 Length:221 Species:Xenopus tropicalis


Alignment Length:215 Identity:106/215 - (49%)
Similarity:149/215 - (69%) Gaps:1/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFTK-IFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLV 64
            |.|: :|||||:|.|||||||:|:.|.||....|:|:||:||.|:...||:|..||.||.:|:||
 Frog     1 MVTRMLFRAVIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRTNVQNKTEIGVVAKSYIDQGQLV 65

  Fly    65 PDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIH 129
            ||.::|:.:|..:.::...:::||||||.:.||.||.....|::||.|:||...|.||:..||||
 Frog    66 PDDVITRLVLQELHKINETNWLLDGFPRTVPQAVALDKAFHINSVIDLNVPFQTIKDRLTARWIH 130

  Fly   130 APSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATF 194
            ..||||||..|..||||..||:|||||:|||||||..|.:||:.|:.:..||:.:|:.||::.||
 Frog   131 PASGRVYNTEFNPPKVPEVDDLTGEPLVQREDDKPETVTRRLKGYEALTRPVLEYYQNKGVLETF 195

  Fly   195 KGKQTKEIWPMMELFLNDRI 214
            .|.:|.:|||.:..||..::
 Frog   196 SGTETNKIWPHVYAFLQSKL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 102/203 (50%)
ADK 7..201 CDD:238713 98/193 (51%)
ak3XP_012812420.1 adk 8..212 CDD:273569 102/203 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3267
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 1 1.000 - - FOG0003066
OrthoInspector 1 1.000 - - otm48064
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2043
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.