DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk3 and ak5

DIOPT Version :9

Sequence 1:NP_001287279.1 Gene:Adk3 / 41318 FlyBaseID:FBgn0042094 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001093554.1 Gene:ak5 / 100003595 ZFINID:ZDB-GENE-030131-8256 Length:563 Species:Danio rerio


Alignment Length:200 Identity:52/200 - (26%)
Similarity:95/200 - (47%) Gaps:36/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKK---AKQYIAEGKLVPDAIVT 70
            :|||.|||||||....|.:.:|..::|.|::||:.:|.|....:|   ..:.|..|:|.|.....
Zfish   136 LIIGGPGSGKGTQCLKIAERYGFEYVSVGELLRKKMIHNATSNRKWSLIARIITNGELAPQETTI 200

  Fly    71 KTMLARITEVGNRS-YILDGFPRNIAQAEALAAREQI---DAVITLDVPHSVIIDRVKNRWIHAP 131
            ..:..:|.::...| .::|||||::.|  ||:..:|:   |.|:.|...:..:.:|::.|     
Zfish   201 TEIKQKIMKIPEASGIVIDGFPRDVGQ--ALSFEDQVCTPDLVVFLACSNQRLKERLEKR----- 258

  Fly   132 SGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKG 196
                             .:..|.|     ||.|..:.:||..:.:...|::.::::|||:.|...
Zfish   259 -----------------AEQQGRP-----DDNPKAIDRRLTNFKQNAIPLVKYFQEKGLIVTLDA 301

  Fly   197 KQTKE 201
            .:.:|
Zfish   302 DRDEE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk3NP_001287279.1 adk 7..211 CDD:273569 51/199 (26%)
ADK 7..201 CDD:238713 51/198 (26%)
ak5NP_001093554.1 aden_kin_iso1 133..317 CDD:130427 51/199 (26%)
ADK 134..308 CDD:238713 51/199 (26%)
aden_kin_iso1 375..562 CDD:130427
ADK 379..552 CDD:238713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.