DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and ARRDC1

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_006717383.1 Gene:ARRDC1 / 92714 HGNCID:28633 Length:466 Species:Homo sapiens


Alignment Length:468 Identity:103/468 - (22%)
Similarity:163/468 - (34%) Gaps:146/468 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VGEDGKTTKSLVTHTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQ 123
            :|..|.:.|:..|....|..|..........|    .||.|::.|||:..:|..|||||.|..|:
Human    53 IGSCGVSNKANDTAWVVEEGYFNSSLSLADKG----SLPAGEHSFPFQFLLPATAPTSFEGPFGK 113

  Fly   124 IKHEVTLTIDRAVRYNNTFKQC---FTVILPHDLNRRLEY-----------------KEPLQRLE 168
            |.|:|...| ...|::...| |   |.::.|.:||...:.                 |:|.....
Human   114 IVHQVRAAI-HTPRFSKDHK-CSLVFYILSPLNLNSIPDIEGSSLRTPAKPLPGPPPKQPNVASA 176

  Fly   169 SKSFWW-----GSIFGAHKPMIMDVSTSYSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSY 228
            :|.|.:     ||:       ::..||....||.||.:..|..::|||......|...|::.|||
Human   177 TKKFSYKLVKTGSV-------VLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSY 234

  Fly   229 RANSSGAKEQLKVTESRVADKHCGEVLKHNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAK 293
            :     ||..:....: :|:.....|....:|::.|.:.||....|.......|.:.|.|:...|
Human   235 K-----AKRWIHDVRT-IAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLK 293

  Fly   294 TFKLHGGGDLVMDFPITIGTV----------PLLGSADDKGPGA-----------EKSQPSGASH 337
                  ..:..:..|:.||.:          |.||..    |||           |:::...|: 
Human   294 ------APEATVTLPVFIGNIAVNHAPVSPRPGLGLP----PGAPPLVVPSAPPQEEAEAEAAA- 347

  Fly   338 PGSPNFQEDVSDEQFESNTFKPRYPVY-------------PFDGKPGTNGSNGAANFPSLYPKAE 389
             |.|:|.:.|.   ..:.:...|.|:.             |.||.|.                  
Human   348 -GGPHFLDPVF---LSTKSHSQRQPLLATLSSVPGAPEPCPQDGSPA------------------ 390

  Fly   390 EAHPATPVKFTPNPVSPAAQKSPPY----------TTNTPVASPPGGNFEVLGFSIPPDYK---- 440
             :||..|      |:..:...:.||          ||:|.:              :||:|.    
Human   391 -SHPLHP------PLCISTGATVPYFAEGSGGPVPTTSTLI--------------LPPEYSSWGY 434

  Fly   441 PTPSAPAASSTGG 453
            |...:.|.:..||
Human   435 PYGESTARAWQGG 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 30/98 (31%)
Arrestin_C 182..313 CDD:280848 30/130 (23%)
ARRDC1XP_006717383.1 Arrestin_N <70..146 CDD:304627 26/81 (32%)
Arrestin_C 186..307 CDD:280848 32/139 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.