DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and ARRDC4

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_899232.2 Gene:ARRDC4 / 91947 HGNCID:28087 Length:418 Species:Homo sapiens


Alignment Length:436 Identity:100/436 - (22%)
Similarity:164/436 - (37%) Gaps:80/436 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNFVFDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSL 69
            :..||:....|.|.:|:.::|...|....|..:|::.:...|.....|..|  .......:|.:|
Human    20 LGLVFEDERKGCYSSGETVAGHVLLEASEPVALRALRLEAQGRATAAWGPS--TCPRASASTAAL 82

  Fly    70 VTHTTTE---VYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAP--TSFNGAHGQIKHEVT 129
            ...:..|   |..|..:|   .||...:.|..||:.||||..: |:.|  |||.|.:|.|::.|.
Human    83 AVFSEVEYLNVRLSLREP---PAGEGIILLQPGKHEFPFRFQL-PSEPLVTSFTGKYGSIQYCVR 143

  Fly   130 LTIDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSA 194
            ..::|....:.:.|:...|:...|:|........|:..|.....|   |....|:.:........
Human   144 AVLERPKVPDQSVKRELQVVSHVDVNTPALLTPVLKTQEKMVGCW---FFTSGPVSLSAKIERKG 205

  Fly   195 YVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHC-------- 251
            |..|:.|..:..::|.|. :.:..|..:.:..:|.|  ||..:.::...:.|...|.        
Human   206 YCNGEAIPIYAEIENCSS-RLIVPKAAIFQTQTYLA--SGKTKTIRHMVANVRGNHIASGSTDTW 267

  Fly   252 -GEVLKHNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVP 315
             |:.||           :||.|||. .:...|||.|:|   |....:.|...|:::.|:.|||:|
Human   268 NGKTLK-----------IPPVTPSI-LDCCIIRVDYSL---AVYIHIPGAKKLMLELPLVIGTIP 317

  Fly   316 LLGSADDKGPGAEK-------------SQPSGASHPGSPNFQEDVSDEQFESNTFKPRYPVYPFD 367
            ..|........|.:             .||.     ..||:.:.||:|:|..:       :.|:.
Human   318 YNGFGSRNSSIASQFSMDMSWLTLTLPEQPE-----APPNYADVVSEEEFSRH-------IPPYP 370

  Fly   368 GKPGTNGSNGAANF----------PSLY----PKAEEAHPATPVKF 399
            ..|...|......|          |.||    |...:...:.||.|
Human   371 QPPNCEGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEESQPVSF 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 40/154 (26%)
Arrestin_C 182..313 CDD:280848 31/139 (22%)
ARRDC4NP_899232.2 Arrestin_N 26..169 CDD:278754 38/148 (26%)
Arrestin_C 191..318 CDD:214976 33/144 (23%)
PPxY motif 1. /evidence=ECO:0000305 350..353 1/2 (50%)
PPxY motif 2. /evidence=ECO:0000305 395..398 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10233
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.