DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and RIM8

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_011470.4 Gene:RIM8 / 852837 SGDID:S000003013 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:45/202 - (22%)
Similarity:80/202 - (39%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTTEV 77
            |..:::..:.|:|  |.:.:..:.|.::.|.::...|.|.:.......::.:..|:|...|   .
Yeast    46 PHRVWKPNESITG--EAVIDIKRDITNVAIKLSLVCEVRVKTGNSPTSKNKRIEKTLEKST---F 105

  Fly    78 YYSTDQPVYGQAGGSQLE-------------LPTGKYVFPFRATIPPNAP--TSFNGAHGQIKHE 127
            .|..|   |.:...|..|             |..|::.||||..||....  :|.....|.|.:.
Yeast   106 LYGQD---YVKTAFSAKEKKPHVDKTTILNGLSKGEHRFPFRIRIPRGRGMLSSIKFERGSITYF 167

  Fly   128 VTLTIDRAVRYNNTFK---QC---FTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIM 186
            ::.|::.....|...|   :|   |.||:|.|::|..:.|.....|:|.|.    :.........
Yeast   168 LSCTLESLNNINGLKKPEARCEREFAVIVPLDVS
RLPKPKTKTVVLQSASM----VQNKKNKSTE 228

  Fly   187 DVSTSYS 193
            |.|:||:
Yeast   229 DESSSYT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 36/162 (22%)
Arrestin_C 182..313 CDD:280848 4/12 (33%)
RIM8NP_011470.4 Arrestin_N 39..201 CDD:419887 36/162 (22%)
Arrestin_C 259..392 CDD:397050
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.