DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and ECM21

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_009449.1 Gene:ECM21 / 852173 SGDID:S000000197 Length:1117 Species:Saccharomyces cerevisiae


Alignment Length:408 Identity:79/408 - (19%)
Similarity:133/408 - (32%) Gaps:134/408 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EERVG----------------ED-GKTTKSLVTHTTTEVYYSTDQPVYGQAGGSQLELPTGKYVF 103
            :||:|                || .|.|..::.....:.|.|...|.:..|.|.....|:   |.
Yeast   716 KERLGITEPIIIETKLKFPKYEDLDKRTAKIIPPYGIDAYTSIPNPEHAVANGPSHRRPS---VI 777

  Fly   104 PFRATIPPNAPTSFNGAHGQIKHEVTLTIDRAVRYNNTFKQCFTVI-----LPHDLNRRLEYKEP 163
            .|           .:|..|...||..   ::.| |:..|.|  |:|     ||...:.||  ..|
Yeast   778 GF-----------LSGHKGSKSHEEN---EKPV-YDPKFHQ--TIIKSNSGLPVKTHTRL--NTP 823

  Fly   164 LQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSY 228
            .:.|...|..:.:::..||..||...:......|.:..|:.:::|..            |..||.
Yeast   824 KRGLYLDSLHFSNVYCRHKLEIMLRISKPDPECPSKLRHYEVLIDTP------------IFLVSE 876

  Fly   229 RANSSGAKEQLKVTESRVADKHCGEV-LKHNK----------AKFDEFLTVPPT-------TPST 275
            :.||...  :|...:....:....:| |..|.          ..|:|.::||.:       :|:.
Yeast   877 QCNSGNM--ELPTYDMATMEGKGNQVPLSMNSDFFGNTCPPPPTFEEAISVPASPIVSPMGSPNI 939

  Fly   276 QSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPLLGSADDKG-PGAEKSQPSGASHPG 339
            .:..||..:|.....:::|..:.|..                |.:||.| |...::..|.|:   
Yeast   940 MASYDPDLLSIQQLNLSRTTSVSGPS----------------GYSDDAGVPNVNRNSISNAN--- 985

  Fly   340 SPNFQEDVSDEQFESNTFKPRYPVYPFDGKPGTNGS----------NGAANFPSLYPKAEEAHPA 394
              .....:|:..|.|                |.:|.          |..:.|.:|          
Yeast   986 --AMNGSISNSAFVS----------------GNSGQGVARARATSVNDRSRFNNL---------- 1022

  Fly   395 TPVKFTPNPVSPAAQKSP 412
            ..:..||:||:.:...||
Yeast  1023 DKLLSTPSPVNRSHNSSP 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 27/120 (23%)
Arrestin_C 182..313 CDD:280848 25/148 (17%)
ECM21NP_009449.1 Arrestin_C 585..>648 CDD:214976
Arrestin_C <781..878 CDD:413500 27/116 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.