DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and ART10

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_013496.3 Gene:ART10 / 851108 SGDID:S000004384 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:276 Identity:56/276 - (20%)
Similarity:96/276 - (34%) Gaps:80/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERV---------GEDGKTTKSLVTH 72
            |.:...:||...|...:..:||.|.:.:.|:.||..:..:|.:         |:|.|:     .|
Yeast    18 YSSNDQMSGIVSLQLTKALSIRKISVILKGFSETLTKIDQEYMFQQNGMMMPGQDNKS-----FH 77

  Fly    73 TTTEVYYSTDQP--VYGQAGGSQ--LELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTID 133
            |..:.......|  |:....||.  .::..|.|.:.|:....|..|..       :|:....|:.
Yeast    78 TLMKFEQRVFPPDNVWNALDGSSKPFKVKPGSYNYSFQFDKFPRKPEC-------LKNHTAKTVA 135

  Fly   134 RAVRYN-------NTFKQCFTVILPHDLN----RRLEYKEPLQRLESKSFWWGSIFGAHKPMIMD 187
            ...|.|       |:..|.|..|...||.    .::.|...:|....||..|...|  || :|.:
Yeast   136 FVTRSNARLPPTFNSHWQEFNKIDNLDLYFYSFGKVIYMVQVQLELGKSSSWFKPF--HK-LIRE 197

  Fly   188 VSTSYSAYVPGQKIHFHLVLD----------------------------NQSDVQCMDVKVRLIK 224
            :.|  ..::|..|   .|:::                            |.|:::.....|:::.
Yeast   198 IET--FEFIPEPK---DLIIEPDEDDNEELNAFSNNSRGNSMVTNNEFFNSSNLKVPSKDVKVVN 257

  Fly   225 NVSY--------RANS 232
            .|.|        :|||
Yeast   258 GVGYIKSDRNFSQANS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 34/157 (22%)
Arrestin_C 182..313 CDD:280848 14/87 (16%)
ART10NP_013496.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.