DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and LOC799768

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_009300042.3 Gene:LOC799768 / 799768 -ID:- Length:377 Species:Danio rerio


Alignment Length:353 Identity:77/353 - (21%)
Similarity:133/353 - (37%) Gaps:64/353 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTTE 76
            |....:.:|.::.|...|...:..|:.|:|:...|..:..|.|.|.:..:.             |
Zfish    39 NESNTFNSGDIVEGRVLLEVTKNLTVDSLFVKFTGGAKVYWTEGESKYHDH-------------E 90

  Fly    77 VYYSTDQPVY-GQAGGSQLELPTGKYVFPFRATIP-PNAPTSF----NGAHGQIKHEVTLTIDRA 135
            .|:...|.:. |::|..:..:..|::|.||:..:| .|.|.||    :|.:..|::.:|..:.|.
Zfish    91 RYFKLKQDLTPGRSGKERQIISPGRHVLPFKFQLPEQNLPPSFKEKVSGFNCWIRYALTAKLKRP 155

  Fly   136 VRYNNT-FKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYVPGQ 199
            .:..:| :.:...|...|..|..|  .:|..|.:...    :.|.:.| :.:..:|..:.|:.|:
Zfish   156 FKSASTAYAELTFVPRSHVTNDHL--LKPQNRTDKMK----NTFSSGK-ISLTATTDKTGYMLGE 213

  Fly   200 KIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVA--DKH-------C---G 252
            .|...:.:||.|.   .|.|::.           ..|:|.....||..  .||       |   |
Zfish   214 TIKVCVDIDNASS---RDAKLKY-----------SLKQQQMFIASRTTKRSKHIIQETSDCIPSG 264

  Fly   253 EVLKHNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPLL 317
            |     |.:|...:.:|.....:......|||.|.|:.   :..:....|..:.||:.| ..||.
Zfish   265 E-----KRRFLVNIKLPRDIMVSFENCRIIRVLYLLKV---SLDVSFASDPAVKFPVVI-IPPLQ 320

  Fly   318 GSADDKGPGAEKSQPSGASHPGS--PNF 343
            .....:.|......|....|||.  |.|
Zfish   321 QCPPWQDPPPPYMPPQPVPHPGGAPPPF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 32/149 (21%)
Arrestin_C 182..313 CDD:280848 31/142 (22%)
LOC799768XP_009300042.3 Arrestin_N 39..158 CDD:328947 29/131 (22%)
Arrestin_C 194..319 CDD:308405 31/148 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.