DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrdc2

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_012821263.1 Gene:arrdc2 / 780156 XenbaseID:XB-GENE-946088 Length:418 Species:Xenopus tropicalis


Alignment Length:449 Identity:113/449 - (25%)
Similarity:182/449 - (40%) Gaps:101/449 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VNFVFDSNPL--GLYQAGQLISGTAELITERPKTIRSIFITINGYG--ETRWQESEERVGEDGKT 65
            ::|..|.:|.  .:|.||:::.|  :::.|..|.:|...:.:.|.|  ...|.||.. ||.:  |
 Frog    25 ISFSLDLSPSVHKVYSAGEIVEG--KVVLELCKELRVSALEVCGRGLATVHWLESRS-VGMN--T 84

  Fly    66 TKSLVTHTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTL 130
            ..|  ..|:.|.|....|.:. :..|:...||.|::.|||...:|....|||.|.||.:::.|..
 Frog    85 VYS--DFTSYETYLRKRQHLI-RDNGTLTMLPAGRHEFPFSFQLPETLVTSFEGKHGSVRYWVKA 146

  Fly   131 TIDRAVRYNNTFKQCFTVILPHDLNR------RLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVS 189
            .:.|........|:.||||.|.|:|.      :...||.:...     |:.::  .|..:...:.
 Frog   147 KLHRPWCTVKKVKKEFTVIEPIDINTPDLLAPQAGSKEKIAHA-----WYCNL--GHVSVTAKID 204

  Fly   190 TSYSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCGEV 254
            .  ..|.||:.|.....:|| ...:.:..|..:|::.::.|.  |..:|.|...:.:|    |:.
 Frog   205 R--KGYTPGEVIPIFAEIDN-CTTRAVIPKAAIIQSQAFVAR--GTMKQKKSVVATLA----GDA 260

  Fly   255 LK-------HNKAKFDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIG 312
            :.       |.:|     |.:||..||....: .|||.|||:...   ::.|..:||::.|:.||
 Frog   261 VPAGKRETWHGRA-----LKIPPLGPSILQCR-IIRVEYTLKVCV---EIPGSSNLVLELPLVIG 316

  Fly   313 TVPL--LGSADDKGPGAEKS---------QPSGASHPGSPNFQEDVSDEQFESNTFKPRY----- 361
            |:||  .||. ....|::.|         .|.....|  |::...||:|:.|.|...|.:     
 Frog   317 TIPLHPFGSR-TSSVGSQYSVNLEWLRMTVPEQPEPP--PDYSSVVSEEEAEHNLSPPHHSSMGC 378

  Fly   362 ----PVY----PFDGKPGTNGSNGAANFPSLYPKAEEAHPATPVKFTPNPVSPAAQKSP 412
                |.|    .|..:|           |.||.:.:           |||  |.|...|
 Frog   379 LLEGPFYAYIQEFRNRP-----------PPLYSEVD-----------PNP--PTADIRP 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 46/153 (30%)
Arrestin_C 182..313 CDD:280848 32/137 (23%)
arrdc2XP_012821263.1 Arrestin_N 36..171 CDD:334019 43/142 (30%)
Arrestin_C 195..320 CDD:214976 35/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8042
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.