DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and Arrdc5

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_084075.1 Gene:Arrdc5 / 76920 MGIID:1924170 Length:325 Species:Mus musculus


Alignment Length:346 Identity:73/346 - (21%)
Similarity:119/346 - (34%) Gaps:90/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTTEVYYS 80
            :|.||.:|.|...|..........:.:.:.|.|...|   .|.:||....::.::.:...:..:.
Mouse    16 VYLAGSIIDGQVVLTLNSTLVDPVVKVELVGRGYVEW---NEEIGETRDYSRDVICNNKADYVHK 77

  Fly    81 TDQ-PVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEV-TLTIDR--------- 134
            |.. |:      ....|..|.:.|.|...:||..|::||...|.|.:.| .|.:||         
Mouse    78 TKTFPI------KDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFVQALCLDREHILAKKKL 136

  Fly   135 --AVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESK------SFWWGSIFGAHKPMIMDVSTS 191
              .|:..:.|:|           |.|.........|.|      |..|.|         :.|..|
Mouse   137 YLLVQGISEFRQ-----------RNLSENSVSVEAEKKVSYNCCSQGWVS---------LHVQMS 181

  Fly   192 YSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCGEVLK 256
            .:.||||:|:.|...:.|.:......|...|..:|.|...:..|:.:.:...|        |:|:
Mouse   182 KNTYVPGEKVTFTSEIRNHTGKYIKTVVFALYAHVQYEGFTPSAERRRRADSS--------ELLR 238

  Fly   257 H-NKAKFDEF----------LTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPIT 310
            . ..|:...|          |.:..:..|...|.:.:|.||.|     ...:|        .|.:
Mouse   239 QMANARIPAFNSTTVVSAFNLPLVLSVSSGSQENEIMRTSYEL-----VVTIH--------LPWS 290

  Fly   311 IGTV----PLL------GSAD 321
            :.||    |::      |.||
Mouse   291 LSTVKARLPIIITSTREGQAD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 32/151 (21%)
Arrestin_C 182..313 CDD:280848 28/141 (20%)
Arrdc5NP_084075.1 Arrestin_N 13..128 CDD:304627 28/120 (23%)
Arrestin_C 170..304 CDD:280848 34/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836033
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.