DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and CG18746

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster


Alignment Length:423 Identity:115/423 - (27%)
Similarity:183/423 - (43%) Gaps:70/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGE--DGKTTKSLVT 71
            |.:|..|::.|||||||...:.||:.|:::::.:.|.||.||.|.::|....:  :|::....|.
  Fly     8 FCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVD 72

  Fly    72 HTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTIDRAV 136
            :..|..|      ::|.:...::.:..|...:.|...:|...|:||.|..|:|::.|.:...|..
  Fly    73 YLATRAY------LHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPW 131

  Fly   137 RYNNTFKQCFTVILPHDLN-RRLEYKEPLQRLESKSFWWGSIFGAH-KPMIMDVSTSYSAYVPGQ 199
            :::..|.:|||||...||| ..|..:.|.|....::|   ..|... .|:.|.:|...|.:||||
  Fly   132 KFDLNFNRCFTVIKVMDLN
SESLMLRVPSQVESQRTF---CCFPCRSSPLSMRLSVPQSGFVPGQ 193

  Fly   200 KIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGA---KEQLKVTESRVADKHCGEVLKHNKAK 261
            .:...:::.|.|.|...|:.|:|...|.|.:....|   |::.::..     |..|.|....:.:
  Fly   194 IVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVL-----KTGGGVSTKCRQQ 253

  Fly   262 FDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPLLGSADDKGPG 326
            |...|.||||.|:..:....|::.|.:...|:....|||..|.|  |||||:|||          
  Fly   254 FTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHM--PITIGSVPL---------- 306

  Fly   327 AEKSQPSGASHPGSPNFQEDVSDEQFESNTFKPRYPVYPFDGKP----GT--NGS-----NGAAN 380
                                ....|.|..|:....|....|.|.    |:  ||.     |..|.
  Fly   307 --------------------TKQLQKEPRTWGEVLPPQQLDAKALILIGSEQNGEALGSPNPWAA 351

  Fly   381 FPSLYPK--AEEAHPATPVKFTPNPVSPAAQKS 411
            .||:.|.  ||..|    :...|:..|.:.:||
  Fly   352 DPSIAPPSYAEAKH----ISPDPHKFSKSKKKS 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 43/147 (29%)
Arrestin_C 182..313 CDD:280848 40/133 (30%)
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 43/147 (29%)
Arrestin_C 174..306 CDD:214976 42/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464060
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
109.900

Return to query results.
Submit another query.