DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and CG18745

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_652648.1 Gene:CG18745 / 59141 FlyBaseID:FBgn0042102 Length:433 Species:Drosophila melanogaster


Alignment Length:435 Identity:112/435 - (25%)
Similarity:197/435 - (45%) Gaps:53/435 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHT 73
            ||:||.|.|..|::::|...|..::.|.:::|.:.|.||.||||   .|||..:.:..:.  |..
  Fly     9 FDNNPHGTYFGGEVLTGRVTLKLDKMKLVKAITLNITGYAETRW---IERVTTNRRRRRR--TFC 68

  Fly    74 TTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTLTIDRAVRY 138
            ..|.|.::...:.|....||:.:..|.:.:.|...||...|:||.|:||::::..|:|:.|..::
  Fly    69 GREDYIASKTFLVGSNLSSQVSIEAGIHTYNFVCLIPTECPSSFEGSHGRVRYMATVTLVRPWKF 133

  Fly   139 NNTFKQCFTVILPHDLNRRLEYKEPLQRL-----ESKSF-WWGSIFGAHKPMIMDVSTSYSAYVP 197
            :.::.:||||:...|||    :..||.|:     .||:: .|..   ...|:.:.::...:.:||
  Fly   134 DQSYTRCFTVLKVMDLN
----FDSPLLRVPAHSETSKTYCCWPC---RSDPLALQLTVPQTGFVP 191

  Fly   198 GQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVTESRVADKHCGEVLKHN-KAK 261
            ||.:...:::.|.|.:....:.:..:..|:|.:.......  ..:|..|.:...|:.::.| |..
  Fly   192 GQNVPLSVLVTNDSHIPVEQLLISFVMLVTYHSKPPSMPN--TTSERLVVNTFKGDAVQRNCKKL 254

  Fly   262 FDEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPLLGSADDKGPG 326
            |...:.||.|.|:..:....|:::|.:...|:....|  .:.|:..|:|||:|||......:..|
  Fly   255 FSYEIRVPATPPTCFNLCGIIQIAYQVEVEARVKGCH--NNEVVTIPLTIGSVPLAQHVPIQPRG 317

  Fly   327 ------------AEKSQPSGASHPGS-------PNFQEDV---SDEQFESNTFKPRYPVYPFDGK 369
                        .|.:....:|.|.|       ||:||.|   |.....|:......||     .
  Fly   318 FVPQLNVNELAVEEVATAPNSSSPWSVDASIPPPNYQEAVHMRSTAATRSDDLDDPEPV-----P 377

  Fly   370 PGTNGSNGAANFPSLYPKAEEAHPAT--PVKFTPNPVSPAAQKSP 412
            |.|...:|.|..| |||..:...|:.  |..:|.|.::..|..:|
  Fly   378 PNTLSLDGGAYKP-LYPVFDIPSPSAPPPTDYTQNYMAERAFVNP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 45/145 (31%)
Arrestin_C 182..313 CDD:280848 27/131 (21%)
CG18745NP_652648.1 Arrestin_N 5..150 CDD:278754 45/145 (31%)
Arrestin_C 174..304 CDD:280848 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464058
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
109.900

Return to query results.
Submit another query.