DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and CG18744

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster


Alignment Length:441 Identity:108/441 - (24%)
Similarity:165/441 - (37%) Gaps:115/441 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKVNFVFDSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESE----ERVGE 61
            ||.:.....| ||.|:|:||..::|...|.......|::|.:..|||..|.||:.:    ::..|
  Fly     1 MSHRCEIQLD-NPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNE 64

  Fly    62 DGKTTKSLVTHTTTEVYYSTDQPVYGQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKH 126
            .....:||......:.:...|..|..:|...|: :..|.|.:.|...:|.|.|.:|.|.||.|::
  Fly    65 QPVVVQSLDFDYRVDYFAKIDYFVGSEAAQPQI-MEAGTYNYGFHVKLPKNCPGNFEGGHGHIRY 128

  Fly   127 EVTLTI----DRA-----VRYNNTFKQCFTVILPHDLNR-----RLEYKEPLQRLESKSFWWGSI 177
            .:.:.|    ||.     ||....|.|       :.|::     .::..|...||.   ||.   
  Fly   129 TLQVLIHSSADRPLEVLHVRQLQIFPQ-------NSLSQETRSCEIQIYEQTPRLR---FWM--- 180

  Fly   178 FGAHKPMIMDVSTSYSAYVPGQKIHFHLVLDNQSDVQCMDVKVRLIKNVSYRANSSGAKEQLKVT 242
                ||:.:.:......|.||..|..||.|.|...:...:....|::..:|.|:.....::|:..
  Fly   181 ----KPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETK 241

  Fly   243 ESR---VADKHCGEVLKHN--KAKFDEF-----LTVPPTTP--------------------STQS 277
            ..|   ::.:|  |:  ||  :.:...|     |.||.|..                    :||.
  Fly   242 VERQTVLSSRH--EL--HNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQ 302

  Fly   278 EKDPIRVSYTLRFIAKTFKLHGG-------GDLVMDFPITIGT----VPLLGSADDKGPGAEKSQ 331
            ||         |.||....:..|       |.|:|..||. ||    .|.:.:|....|....|.
  Fly   303 EK---------RLIAARMPVIIGNVTPPCPGKLLMQEPID-GTAPEPTPPVETASTLIPNFSIST 357

  Fly   332 PSGASHPGSPNFQED---------------VSDEQFESNTFKPRYPVYPFD 367
            .|.||     ||:|.               :|.||.:   |:|||..|..|
  Fly   358 TSLAS-----NFREAEFMVATNLNKTNKHYLSGEQLD---FRPRYVYYEMD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 42/162 (26%)
Arrestin_C 182..313 CDD:280848 37/167 (22%)
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 37/137 (27%)
Arrestin_C 179..322 CDD:214976 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464081
Domainoid 1 1.000 52 1.000 Domainoid score I3293
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
98.900

Return to query results.
Submit another query.