DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrdc3a

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001073498.1 Gene:arrdc3a / 566685 ZFINID:ZDB-GENE-030131-2913 Length:414 Species:Danio rerio


Alignment Length:434 Identity:103/434 - (23%)
Similarity:167/434 - (38%) Gaps:73/434 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DSNPLGLYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTT 74
            ||| :.::.:|..:||...:.......::|:.|...|:.:.||.||...    |.:| :...:.|
Zfish    18 DSN-VPVFSSGDSVSGRVIIEVTGEIRVKSLKINAKGFAKVRWTESRNA----GSST-AYTQNYT 76

  Fly    75 TEVYYSTDQPVY---------GQAGGSQLELPTGKYVFPFRATIPPNAPTSFNGAHGQIKHEVTL 130
            .||.|...:.:.         .:.|.:.:.....:|.|.|.....|.| |||.|.||.:::.|..
Zfish    77 EEVEYLNHRDILIGHERDDDNSEEGLTTIHSGRHEYAFSFELPQTPLA-TSFEGKHGSVRYWVKA 140

  Fly   131 TIDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAY 195
            .:.|........|:.|||....|:|..|.........|.....|   |....|:.:........|
Zfish   141 ELHRPWLLPMKTKKEFTVFEHIDINTPLLLSPQAGTKEKTLCCW---FCTSGPISLSAKIERKGY 202

  Fly   196 VPGQKIHFHLVLDNQSDVQCMDVKVRLI--KNVSYRANSSGAKEQLKVTESRVADKHCGEVLKHN 258
            .||:.|.....::|.|.        |::  |...|:..:..||.::|..:..||:.. ||.|...
Zfish   203 TPGESIQIFAEIENCSS--------RMVVPKAAIYQTQTFFAKGKMKEIKQLVANIR-GESLSSG 258

  Fly   259 KAKF--DEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL--LGS 319
            |.:.  .:.|.:||.:||. .:...|||.|:|....   .:.|..:|.::.|:.|||:||  .||
Zfish   259 KTETWNGKMLKIPPVSPSI-LDCSIIRVEYSLMVYV---DIPGAMNLSLNLPLVIGTIPLHPFGS 319

  Fly   320 ADDKGPGAEKSQPS------GASHP----GSPNFQEDVSDEQFESNTFKPRYPVYPFDGKPGTNG 374
            .    ..:..||.|      |.:.|    ..|.:.|.|::||.::          ..:..||...
Zfish   320 R----TSSVSSQCSMTMSWLGMALPERPEAPPAYAEVVTEEQRQN----------CLEVSPGREN 370

  Fly   375 SNGAANFPSLYPKAEEAHPATPVKFTPNPVSPAAQKSPPYTTNT 418
            .:|     .|:...:|      .:|.|.|........|...|:|
Zfish   371 YDG-----PLFAYIQE------FRFRPPPPYSEIDPHPDQATST 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 38/153 (25%)
Arrestin_C 182..313 CDD:280848 33/134 (25%)
arrdc3aNP_001073498.1 Arrestin_N 22..165 CDD:278754 35/148 (24%)
Arrestin_C 188..311 CDD:280848 33/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.