DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and Txnip

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001009935.1 Gene:Txnip / 56338 MGIID:1889549 Length:397 Species:Mus musculus


Alignment Length:372 Identity:82/372 - (22%)
Similarity:144/372 - (38%) Gaps:63/372 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SNPLGLYQAGQLISGTAELITE-----RPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLV 70
            ::|..:|.:|:.::|  .:|.|     |.|.:|   |...|..:..|.:..::.    |.|...:
Mouse    15 NDPEKVYGSGEKVAG--RVIVEVCEVTRVKAVR---ILACGVAKVLWMQGSQQC----KQTLDYL 70

  Fly    71 THTTTEVYYSTDQPVYGQAGGSQLEL--PTGKYVFPFRATIPPNAP--TSFNGAHGQIKHEVTLT 131
            .:..|.:.  .:||.   ||.:::.:  |..||.:.|...: |..|  |||.|.:|.:.:.|...
Mouse    71 RYEDTLLL--EEQPT---AGENEMVIMRPGNKYEYKFGFEL-PQGPLGTSFKGKYGCVDYWVKAF 129

  Fly   132 IDRAVRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSA-- 194
            :||..:.....|:.|.|:...|:|.. :...|:...:.|..  ..:|      |.|...|.||  
Mouse   130 LDRPSQPTQEAKKNFEVMDLVDVN
TP-DLMAPVSAKKEKKV--SCMF------IPDGRVSVSARI 185

  Fly   195 ----YVPGQKIHFHLVLDNQSDVQCMDV---KVRLIKNVSYRANSSGAKEQLKVTESRVADKHCG 252
                :..|..|..|...:|    .|..:   |..::...:|.||.     |.||...:::.....
Mouse   186 DRKGFCEGDDISIHADFEN----TCSRIVVPKAAIVARHTYLANG-----QTKVFTQKLSSVRGN 241

  Fly   253 EVLKHNKAKF-DEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL 316
            .::....|.: .:.|.|....||... .:.::|.|:|....   .:.|...:::|.|:.||:...
Mouse   242 HIISGTCASWRGKSLRVQKIRPSILG-CNILKVEYSLLIYV---SVPGSKKVILDLPLVIGSRSG 302

  Fly   317 LGSADDKGPGAEKSQPSG-----ASHPGSPNFQEDV--SDEQFESNT 356
            |.|..........|:.|.     ...|.:|....|:  .|.:.||.|
Mouse   303 LSSRTSSMASRTSSEMSWIDLNIPDTPEAPPCYMDIIPEDHRLESPT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 37/152 (24%)
Arrestin_C 182..313 CDD:280848 29/140 (21%)
TxnipNP_001009935.1 Arrestin_N 10..153 CDD:304627 37/152 (24%)
Arrestin_C 175..299 CDD:280848 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.