DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14696 and arrdc3

DIOPT Version :9

Sequence 1:NP_650035.1 Gene:CG14696 / 41317 FlyBaseID:FBgn0037853 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001016843.1 Gene:arrdc3 / 549597 XenbaseID:XB-GENE-5732341 Length:412 Species:Xenopus tropicalis


Alignment Length:432 Identity:102/432 - (23%)
Similarity:157/432 - (36%) Gaps:95/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYQAGQLISGTAELITERPKTIRSIFITINGYGETRWQESEERVGEDGKTTKSLVTHTTTEVYYS 80
            :|.:|..:||...|.......::|:.|...|:.:.||.||...    |..|.....:|....|:|
 Frog    23 VYSSGDAVSGRVNLEVTGEIRVKSLRIHARGHAKVRWTESRNA----GSNTAYTQNYTEEVEYFS 83

  Fly    81 TDQPVYG--------QAGGSQLELPTGKYVFPFRATIPPNAP--TSFNGAHGQIKHEVTLTIDRA 135
            ....:.|        :.|.:.:.....:|.|.|..   |..|  |||.|.||.:::.|...:.|.
 Frog    84 HKDILIGHERDDDNSEEGLTTIHSGRHEYAFSFEL---PQIPLATSFEGRHGSVRYWVKAELHRP 145

  Fly   136 VRYNNTFKQCFTVILPHDLNRRLEYKEPLQRLESKSFWWGSIFGAHKPMIMDVSTSYSAYVPGQK 200
            .......|:.|||....|:|............|.....|....|   |:.:........|.||:.
 Frog   146 WLLPVKLKKEFTVFEHIDIN
TPSLLAPQAGTKEKTLCCWLCTSG---PISLSAKIERKGYTPGES 207

  Fly   201 IHFHLVLDNQSDVQCMDVKVRLI--KNVSYRANSSGAKEQLKVTESRVADKHCGEVLKHNKAKF- 262
            |.....::|.|.        |::  |...|:..:..||.::|..:..||:.. ||.|...|.:. 
 Frog   208 IQIFAEIENCSS--------RMVVPKAALYQTQTFYAKGKMKEVKQLVANLR-GESLSSGKTETW 263

  Fly   263 -DEFLTVPPTTPSTQSEKDPIRVSYTLRFIAKTFKLHGGGDLVMDFPITIGTVPL--LGSADDKG 324
             .:.|.:||.:||. .:...|||.|:|....   .:.|..||.::.|:.|||:||  .||.    
 Frog   264 NGKLLKIPPISPSI-IDCSIIRVEYSLMVYV---DIPGAMDLFLNLPLVIGTIPLHPFGSR---- 320

  Fly   325 PGAEKSQPS-----GASHP----GSPNFQEDVSDEQFESNTFKPRYPVYPFDGKPGTNGSNGAAN 380
            ..:..||.|     |.:.|    ..|::.|.|::||                 :.....||...|
 Frog   321 TSSVSSQYSINNWLGLTLPERPEAPPSYAEVVTEEQ-----------------RQNLMSSNACDN 368

  Fly   381 F-------------------PSLYPKAE-------EAHPATP 396
            |                   |.||.:.:       |.||:.|
 Frog   369 FELALQGPLFAYIQEFRFLPPPLYSEVDPNPDQPTEEHPSCP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14696NP_650035.1 Arrestin_N 5..155 CDD:278754 37/148 (25%)
Arrestin_C 182..313 CDD:280848 34/134 (25%)
arrdc3NP_001016843.1 Arrestin_N 9..165 CDD:334019 37/148 (25%)
Arrestin_C 187..314 CDD:214976 37/142 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8042
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.